Listeria TRDM Database

LmTDRM Database

Thiol: Disulphide Redox Metabolic Database

GENE ANNOTATION

Gene IdLmo0222
Protein IdQ8YAC4
GenBank IdNP_463753.1
NCBI Gene NameHeat shock protein 33 (hsIO)
Sequence>gi|16409587|emb|CAD00749.1| lmo0222 [Listeria monocytogenes EGD-e] MSDYLVKALAYDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGD GPIGPIVADSNAQGQIRGYVTNPHVHFSELNEAGKLDVRRGVGTSGMLSVVKDLGFGENFTGQTPIVSGE IGEDFTYYLATSEQINSSVGVGVLVNPDDTIEAAGGFMLQLLPGATDEIIDEIEKNLMALPTVSRMIEAG ETPESILAKLAGGEDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNTYD FSEEELKTLYEEAK
FunctionRedox-switch chaperone (hsp33)
MotifCXXC
LocationC-terminal
Phylogenetic Clustering
Gene IdLmo0279
Protein IdQ8YA80
GenBank IdNP_463810.1
NCBI Gene NameAnaerobic ribonucleoside triphosphate reductase
Sequence>gi|16409644|emb|CAD00806.1| lmo0279 [Listeria monocytogenes EGD-e]
MYVEQLNEQMVIKRDGRKASFDLIKIRNAVEASMKAINLEDETFLEEILLEVVSELPNKADMTIDEIQHCVENTLMKSTY
PDVARAYIEYRHDRDHERENITDMHKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHL
KGEIHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVASSQYGGCSVDRIDEVLSVY
ARLNFEKHKKDAMEWVVPEKQEGYAAEKTRKDIYDAMQSLEYEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVR
IGGVGKDKHTAIFPKLVFSIRRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWENE
NGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQARPENAPILYKYGAFGKRLQDGE
DVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDKEAKNFTLDIVKELKAYADNWKDEYGYWFSVYSTPSESLTDRFNR
LDKEKYGVIKDITDKDYYQNSFHYDVRKKIDFEKDYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYDRVAYLGTNTPI
DKCYECDFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKRPMVHGRHVEISNRVKHMENLGE
FunctionAnaerobic ribonucleotide reductase subunit D(nrdD)
MotifTXXC
LocationN-terminal
Phylogenetic ClusteringMethanogen, Archaeoglobi, Halobacteria
Gene IdLmo0280
Protein IdQ8YA79
GenBank IdNP_463811.1
NCBI Gene NameAnaerobic ribonucleotide reductase activator protein
Sequence>gi|16409645|emb|CAD00807.1| lmo0280 [Listeria monocytogenes EGD-e]
MNNPKPCEWKSNELSRGYIADYKAFNFVDGEGVRCSLYVSGCPFHCEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESV
QGLTLLGGEPFLNTATCLSIVKRIRATYGETKDIWSWTGYTWDEMMQETADKLELLSLIDVLVDGRFEQKLFDPNLAFRG
SSNQRIIDVQKSLAAGEVVLYEL
FunctionAnaerobic ribonucleotide reductase subunit G(nrdG)
MotifTXXC
LocationN-terminal
Phylogenetic ClusteringMethanogen, Archaeoglobi, Halobacteria
Gene IdLmo0906
Protein IdQ8Y8J5
GenBank IdNP_464432.1
NCBI Gene NameGlutathione reductase
Sequence>gi|16410309|emb|CAC98984.1| lmo0906 [Listeria monocytogenes EGD-e] MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAY
GYQVDASFNFQKLVENREAYIERIRGSYKNGLDNNNVDWIKGYAEFVDEKTLRVNGELVTADHILIATGG
EPALPSIPGAEFGITSDGFFALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLT
DTLTEIIEQSDMTLHKHAIPQKVEKNPDGSLTLSLEDGRTETVDTLIWAIGRKPVIKGLQIEKSGVELLE
SGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRLSERLFNNKKDAHLNYENIPTVVFSHPAIGT
VGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTERVIGLHGIGYGVDEMIQGFAV
AINMGATKADFDNTVAIHPTGSEEFVTMK
FunctionGlutathione reductase (gor/gshR)
MotifCXXC
LocationN-terminal
Phylogenetic Clustering
Gene IdLmo0964
Protein IdQ8Y8E0
GenBank IdNP_464489.1
NCBI Gene NameHypothetical protein
Sequence>gi|16410366|emb|CAC99042.1| lmo0964 [Listeria monocytogenes EGD-e] MINQNLYYQSVANSKPIEIYLFFDPACDDCWNIEANMLRLQMEYGNYFKLRYVLHNNLQTFVCKQKRAGN
SNLSLKEQQIGAHLSYISCLAVKAAELQGKKQGITFLRKIQAAYFLENKDIASDEVLYDIAVSTGLDLSE
FKKDLASTVAKRAYIGDQKVAQEMEIHENPTVVFFNKNIEDAGLKLSGLHRYEVYVHVLSELLNDAPQPE
ERPQMEEYLAKVKVTSSASMADFYGVSEQQIERQMKKWRLQQKVELIDAPAGQSHWKYIGNL
FunctionDxbA-like unkown function
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringBacilli, Geobacilli
Gene IdLmo0983
Protein IdQ8Y8C5
GenBank IdNP_464508.1
NCBI Gene NameGlutathione peroxidase
Sequence>gi|16410385|emb|CAC99061.1| lmo0983 [Listeria monocytogenes EGD-e]
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILGFPCNQFLRQDPGSDEEILEF
CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVIERFPSKMKPEDFEDKVEALVAKVNN
Function Glutathione peroxidase(gpo/gpx)
MotifTXXC
LocationN Terminal
Phylogenetic ClusteringListeria is distantly grouped with other species-Chlorobium,Yersinia
Gene IdLmo1059
Protein IdQ8Y859
GenBank IdNP_464584.1
NCBI Gene Namelmo1059
Sequence>gi|16410461|emb|CAC99137.1| lmo1059 [Listeria monocytogenes EGD-e] MDISQIKAEVVTPETGIHVGEKAAPVKVMSFVNLRCPFCREWNEKSKDVLTEYIQAGKIELIIKPFDKEK
ESLQRGNVTHRYLDYSTPEKTRETINKIYSKQDEWGSLSLDEVATYMESELGLTEQDNKAASEKIVAEAN
AANVVFVPTVIVGEHIFDEHISPEELRSLLDDELAK
FunctionThiol:disulfide oxido reductase (BdbD)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringEnterococci, Mesorhizobium
Gene IdLmo1233
Protein IdP0A4L3
GenBank IdNP_464758.1
NCBI Gene NameThioredoxin (trxA)
Sequence>gi|16803273|ref|NP_464758.1| thioredoxin [Listeria monocytogenes EGD-e] MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMS
IPTLLIKKDGEVVETIIGYRPKEELDEVINKYV
FunctionThioredoxin(TrxA)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringStreptococci, Lactococci, Enterococci, Lactobacilli
Gene IdLmo1433
Protein IdQ8Y768
GenBank IdNP_464958.1
NCBI Gene NameGlutathione reductase
Sequence>gi|16410862|emb|CAC99511.1| lmo1433 [Listeria monocytogenes EGD-e] MAKFTYDVVIIGSGASGTTVAFEAQAAGLKVAIVEERNWGGTCVLRGCDPKKVLIGAREARNLSTRLRGK
GIKQAATISWTDLMAFKETFVENVPESRLASFQEAGIETFFGAASFQDSHSLQVGDDLIYAEKIVIATGA
TPSTLKVEGKEYIQTSDDFLSLEKLPDSVVFIGGGYISFEFASIALAAGRDVHIIHHNSEPLKKFDPDFV
AALVANIKDEGIHFHFDTDITKIENDGGKLHIKGKDSFSLQTDLIIGATGRMPNIAHLSLENASIDYTKK
GIVVNEKLQTPNNPHIYACGDVAATKGAPLTPVVSLEAALVAKNVIGVNEKITYPAIPSVVFTSPKLASI
GISTEEAKANPEKYQIKNHDTTSWYTYKRTNEQIALAKIIEDRESGQIKGAHFLSEEADYMINYIAILMK
ANLTLADLQSVIFAYPSPASDLTALN
FunctionGlutathione reductase 2(gor2)
MotifCXXC
LocationN-terminal
Phylogenetic Clustering
Gene IdLmo1583
Protein IdQ8Y5V24
GenBank IdNP_465108.1
NCBI Gene NameThiol peroxidase (tpx)
Sequence>gi|16411012|emb|CAC99661.1| lmo1583 [Listeria monocytogenes EGD-e] MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEE ASNLDNTVVLTISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVIMKELRLLARSVFVVNAVGEI VYTEVVPEGSDHPNYEAAIEAAKKA
FunctionThiol peroxidase(tpx)
MotifTXXC
LocationN Terminal
Phylogenetic ClusteringListeria is distantly grouped with other species-Chlorobium,Yersinia
Gene IdLmo1604
Protein IdQ8Y5V18
GenBank IdNP_465129.1
NCBI Gene Name2-cys peroxiredoxin
Sequence>gi|16411033|emb|CAC99682.1| lmo1604 [Listeria monocytogenes EGD-e] MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALN ARIIGASTDTIHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQ YEVVHHNNIGREVDEVLRVLQALQTGGLCPINWQPGEKTIV
FunctionPeroxiredoxin(prx)
MotifTXXC
LocationN Terminal
Phylogenetic ClusteringListeria is distantly grouped with other species-Chlorobium,Yersinia
Gene IdLmo1609
Protein IdQ8Y6S4
GenBank IdNP_465134.1
NCBI Gene NameThioredoxin
Sequence>gi|16411045|emb|CAC99687.1| lmo1609 [Listeria monocytogenes EGD-e]
MKNLESVEQFNAIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFSFYHVDRDEFIDLCADLAIFGIPSFLAFEDGE
EVGRFVSKDRKTKEEINDFLAAI
FunctionThioredoxin ramily(ytpP)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringBacilli, Staphylococci
Gene IdLmo1860
Protein IdQ8Y640
GenBank IdNP_465385.1
NCBI Gene NameMethionine sulfoxide reductase A
Sequence>gi|16411314|emb|CAC99938.1| lmo1860 [Listeria monocytogenes EGD-e]
MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
YQVASGRAAFIDANWKG
FunctionProtein methionine S-oxide reductase (MsrA)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringLactobacilli,Enterococci, Streptococci
Gene IdLmo1903
Protein IdQ8Y600
GenBank IdNP_465427.1
NCBI Gene NameThioredoxin
Sequence>gi|16411356|emb|CAC99981.1| lmo1903 [Listeria monocytogenes EGD-e]
MKKIVLLLALITVVLTVGACSDNKKETEEKANKTEEESATFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
KELKKRQPDQKMAYYNTDKASEKSRDNMIALLEKMDIDSVPTMVYLKDGKVASTYAATDEPAKLTNWMNKVSGEVSE
FunctionThioredoxin ramily(ytpP)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringRhodospirulla , xanthobacter
Gene IdLmo2191
Protein IdQ9RGX0
GenBank IdNP_465715.1
NCBI Gene NameArsC family transcriptional regulator (spxA)
Sequence>gi|16411661|emb|CAD00269.1| lmo2191 [Listeria monocytogenes
EGD-e]MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSL
PLQQLFELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN
FunctionTranscriptional reulator(Spx)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringBacilli,Staphylococci, Lactobacilli
Gene IdLmo2152
Protein IdQ929L9
GenBank IdNP_465676.1
NCBI Gene NameThioredoxin
Sequence>gi|16411622|emb|CAD00230.1| lmo2152 [Listeria monocytogenes EGD-e]
MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
LYKGGEEIHRLNGFIPPNKIEEAVSLNA
FunctionThiol:disulfide oxido reductase(trxL)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringXylella, Xanthomonas
Gene IdLmo2153
Protein IdQ8Y5B4
GenBank IdNP_465677.1
NCBI Gene NameFlavodoxin
Sequence>gi|16411623|emb|CAD00231.1| lmo2153 [Listeria monocytogenes EGD-e]
MRILLAYDSLSGNTKMVADEIEEILISEGHEVVSFRVSPLAEYPLDEDFDLYVLGAWTVDYGRTPPDMKDFIAELAVKPK
NVAIFGTGETQWGMDFYCGAVDRMAKYFGTSYPTLKIEQMPHTEQDVADIDNWVRKILALRSGIK
FunctionRegulatory subunit (putative)
MotifCXXC
LocationN-terminal
Phylogenetic Clustering
Gene IdLmo2154
Protein IdQ8Y5B3 
GenBank IdNP_465678.1
NCBI Gene NameRibonucleotide-diphosphate reductase subunit beta (nrdF)
Sequence>gi|16411624|emb|CAD00232.1| lmo2154 [Listeria monocytogenes EGD-e]
MANQKEQLTRIKILEPLFPNRSTSIINGETSGILNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYA
FDAIIGLLATLDSPQTRFIYNIAEYITDPAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNE
PIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGE
NPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYAD
NFTETKTDFFEMRNSSYKKTNMDNGFDDL
FunctionAerobic ribonucleotide reductase subunit B(nrdB)
MotifCXXC
LocationN-terminal
Phylogenetic Clustering
Gene IdLmo2155
Protein IdQ8Y5B2
GenBank IdNP_465679.1
NCBI Gene NameRibonucleotide-diphosphate reductase subunit alpha
Sequence>gi|16411625|emb|CAD00233.1| lmo2155 [Listeria monocytogenes EGD-e]
MKWGLQMTTYIVKDGGNRKLPFDKSRLDGYLEKIHEEFPKLDLEDYKRKVFNFVEKKEDYAADELVDYLIREAEARTDIH
IPEWEHFAARLYLNKLYKKASKNRFYNDDDKYGSYVGLQESLGERGIYSGNILKNYSKEDLIAAGKLIDPEKDKLFTYNG
LYLLATRYLATDSERNVYELPQERWLTIALYLMQNEPKEKRMKLVEEAYWALSNLYMTVATPTLANAGKVGGQLSSCFID
TVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSTGAAIRGVKGASGGVIPWIKQLNNTAVSVDQLGQRKGAIAVYLDV
FHKDIESFLDLRLNNGDQRLRAHDVFTAVCIPDIFMEAVERRGEWYLFDPHEVKAKKGWYLQDFYDESKGEGTFREKYEE
LVADETISKKIVKAIDIMKRIMMSQLETGNPFMFYRDEVNRMNPNKHEGMVYSSNLCTEIMQNMSPTKMIQEIISGDQIV
ITKQAGDFVVCNLSSVNLGRAVVAEEGTLERLIEVEVRMLDNVIDLNELPVPQATITNQKYRSIGLGTFGWHHLLALKNI
AWDSEEAEKYADELYEQINYLAIRASNKLAQEKGAYKVFKGSDWNTGEYFARRNYNSPEWQELAKEVAEKGLRNAYLVAV
APNMSTAQIAGSTASIDPIYSAFYYEEKKDYRRPVIAPDLNLSTYPYYEKGAYKVDQFASVRQNGRRQRHVDQSLSFNFY
VPSGIKASKLLELHMTAWNEGLKTTYYVRSNDIDVEECEWCSS
FunctionAerobic ribonucleotide reductase subunit A(nrdA)
MotifCXXC
LocationN-terminal
Phylogenetic Clustering
Gene IdLmo2344
Protein IdQ8Y4T8
GenBank IdNP_465867.1
NCBI Gene NameHypothetical protein
Sequence>gi|16411832|emb|CAD00422.1| lmo2344 [Listeria monocytogenes EGD-e]
MANVVVWSKEGCHYCKDVKDFLIEQKIVFQDIDVTDHDYLREVLQAKYGICHVPVVEIGNIENGTYQAVTEIGLEHLEKA
LFEKGEVK
FunctionGlutaredoxin(grx)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringBacilli, Shewanella , Syntrophobacter
Gene IdLmo2393
Protein IdQ8Y4P2
GenBank IdNP_465916.1
NCBI Gene NameHypothetical protein
Sequence>gi|16411881|emb|CAD00471.1| lmo2393 [Listeria monocytogenes EGD-e]
MVNEAKLYVYGSTTICASCVGAPSSKETEEWLRAAIGRKFSGQPFVVEYVDIFNPPNETALADMANKIVEEDYMYPVIVV
DGEIIAEGNPRLKDIYQVMTDRGYLATM
FunctionYuzD ortholog unknown function
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringBacilli, Staphylococci
Gene IdLmo2424
Protein IdQ8Y4L3
GenBank IdNP_465947.1
NCBI Gene NameThioredoxin
Sequence>gi|16411912|emb|CAD00502.1| lmo2424 [Listeria monocytogenes EGD-e]
MRTAQKKGEDFVVFFFTPMCGSCQIASRLVDVVIEADGIQTEVAKVNLNYVPDIAQSLEITSVPALVKFKNGQPADLSYQ
LHDATAIFEFLYSE
FunctionThioredoxin family(yusE)
MotifCXXC
LocationN-terminal
Phylogenetic Clustering Bacillus halodurans, Staphylococci, Other Bacilli species
Gene IdLmo2426
Protein IdQ8Y4L1
GenBank IdNP_465949.1
NCBI Gene NameHypothetical protein
Sequence>gi|16411914|emb|CAD00504.1| lmo2426 [Listeria monocytogenes EGD-e]
MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPTAEELQQWHEASGLPVRRFFNTSGIKYRELGLKDKLDTLSPEE
AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK
FunctionArsenate reductase (ArsC)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringStreptococci, Bacilli
Gene IdLmo2478
Protein IdO32823
GenBank IdNP_466001.1
NCBI Gene NameThioredoxin reductase (trxB)
Sequence>gi|16804516|ref|NP_466001.1| thioredoxin reductase [Listeria monocytogenes
EGD-e]
MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVE
EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK
FunctionThioredoxin reductase(TrxB)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringStaphylococci, Bacilli
Gene IdLmo2770
Protein IdQ8Y3R3
GenBank IdNP_466292.1
NCBI Gene NameBifunctional glutamate--cysteine ligase/glutathione synthetase
Sequence>gi|16412270|emb|CAD00983.1| lmo2770 [Listeria monocytogenes EGD-e]
MIKLDMTMLDSFKEDPNLRKLLFSGHFGLEKENIRVTSDGKLALTPHPAIFGPKEDNPYIKTDFSESQIEMITPVTDSID
SVYEWLENLHNIVSLRSENELLWPSSNPPILPAEEDIPIAEYKTPDSPDRKYREHLAKGYGKKIQLLSGIHYNFSFPEAL
IDGLYANISLPEESKQDFKNRLYLKVAKYFMKNRWLLIYLTGASPVYLADFSKTKHEESLPDGSSALRDGISLRNSNAGY
KNKEALFVDYNSFDAYISSISNYIEAGKIESMREFYNPIRLKNAHTDQTVESLAEHGVEYLEIRSIDLNPLEPNGISKDE
LDFIHLFLIKGLLSEDRELCANNQQLADENENNIALNGLAQPSIKNCDNEDIPLADAGLLELDKMSDFIKSLRPEDTKLR
AIIEKQKERLLHPEKTIAAQVKQQVTKEGYVDFHLNQAKTYMEETEALAYKLIGAEDMELSTQIIWKDAIARGIKVDVLD
RAENFLRFQKGDHIEYVKQASKTSKDNYVSVLMMENKVVTKLVLAEHDIRVPFGDSFSDQALALEAFSLFEDKQIVVKPK
STNYGWGISIFKNKFTLEDYQEALNIAFSYDSSVIIEEFIPGDEFRFLVINDKVEAVLKRVPANVTGDGIHTVRELVEEK
NTDPLRGTDHLKPLEKIRTGPEETLMLSMQNLSWDSIPKAEEIIYLRENSNVSTGGDSIDYTEEMDDYFKEIAIRATQVL
DAKICGVDIIVPRETIDRDKHAIIELNFNPAMHMHCFPYQGEQKKIGDKILDFLFD
FunctionGlutathione synthetase(gshF)
MotifNot Applicable
Location
Phylogenetic ClusteringNot Applicable
Gene IdLmo2830
Protein IdQ8Y3K5
GenBank IdNP_466352.1
NCBI Gene NameThioredoxin
Sequence>gi|16412330|emb|CAD01043.1| lmo2830 [Listeria monocytogenes EGD-e]
MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
DGEIKGAIAGIVSCDELRSRFKSLAK
FunctionThioredoxin family(yusE)
MotifCXXC
LocationN-terminal
Phylogenetic ClusteringListeria is distantly grouped with other species-Chlorobium,Yersinia